PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG045600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 440aa    MW: 48708.4 Da    PI: 5.8659
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG045600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.11.1e-131258349
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                         +en+s r+vtf kRr g+ K A  LS+L++a++a+ + s+ gk+  +
  Pavir.2KG045600.1.p 12 VENDSDRSVTFFKRRSGLYKAAADLSTLTGARIAIALESEIGKMSSF 58
                         79*****************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-12161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.269262IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-9424IPR002100Transcription factor, MADS-box
CDDcd002666.21E-16470No hitNo description
SuperFamilySSF554551.09E-15572IPR002100Transcription factor, MADS-box
PfamPF003194.6E-151258IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-92439IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-93960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MTRPRRTGIS YVENDSDRSV TFFKRRSGLY KAAADLSTLT GARIAIALES EIGKMSSFGT  60
PSAGPIIDSF LSGNILVDPS ANEEQKVEIT HMQNEVFVVE REKYMEDRRK QETSARAKEI  120
QETSRKAKLV YGKVEDLSVQ ELNEMVCDLS QIKQEINDGC RPQQPSYQLE VGQLSSSSSL  180
SQIQMPPRRL PWTPRQPSFH LPRSSWSRPQ PSRSHSSLLN SSLLPSAQAQ LRPFFQHSLM  240
PQHPLVVEPQ VQMMLSPIET YQNNYNTQPG IHINGNIPQP FSQSFLVSAL PPPPPPPPSS  300
SAQITFCNEF PPPSSSHELP TPLPKQTELH PTKQYENHAS AQDITIDHSF VNYQWPSPIP  360
FNEPYYDISL YGMNLNLGGH GDYGGQAASE HDMPGPSGLH QHGYDCPYMN ILGSFSSGEC  420
PADYSAGNNL GDMGPLGDS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958932.11e-150PREDICTED: uncharacterized protein LOC101780877
TrEMBLK4A1W61e-153K4A1W6_SETIT; Uncharacterized protein
STRINGSi032862m1e-152(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30892276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.15e-15AGAMOUS-like 61